PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P02790_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MIKC_MADS
Protein Properties Length: 163aa    MW: 18538.3 Da    PI: 9.6831
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P02790_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF947.1e-30959151
                            S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                  SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                            krien + rqvtfskRr+g+lKKA+ELSvLCd+eva+iifss gklye++s
  GSMUA_Achr11P02790_001  9 KRIENATSRQVTFSKRRKGLLKKAFELSVLCDVEVALIIFSSGGKLYEFAS 59
                            79***********************************************86 PP

2K-box45.43.6e-1681142970
                   K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70 
                             + e++ e  + e+a + k+ie ++ ++ +llG++L+s+sl eL++Le +Le+sl +iR++K 
  GSMUA_Achr11P02790_001  81 KMEQDIEGGEYEAAWISKRIELIEASKQKLLGKNLGSCSLDELHELEGKLEESLHSIRERKA 142
                             567778888899*************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.1E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.95161IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-29323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.18E-32384IPR002100Transcription factor, MADS-box
CDDcd002652.33E-39378No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.1E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-293859IPR002100Transcription factor, MADS-box
PROSITE profilePS512978.72986163IPR002487Transcription factor, K-box
PfamPF014861.3E-1589143IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MVRGKREMKR IENATSRQVT FSKRRKGLLK KAFELSVLCD VEVALIIFSS GGKLYEFASS  60
SMLSAIERYR AHSREDSIST KMEQDIEGGE YEAAWISKRI ELIEASKQKL LGKNLGSCSL  120
DELHELEGKL EESLHSIRER KASQNRTYFI SVKLSTKNIL TSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A5e-20372271Myocyte-specific enhancer factor 2A
3mu6_B5e-20372271Myocyte-specific enhancer factor 2A
3mu6_C5e-20372271Myocyte-specific enhancer factor 2A
3mu6_D5e-20372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009382240.11e-96PREDICTED: MADS-box transcription factor 50-like isoform X3
SwissprotO646452e-56SOC1_ARATH; MADS-box protein SOC1
TrEMBLM0RNV91e-114M0RNV9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P02790_0011e-113(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.11e-57AGAMOUS-like 20